Protein Info for LU632_RS01520 in Erwinia tracheiphila SCR3

Annotation: Dam family site-specific DNA-(adenine-N6)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 TIGR00571: DNA adenine methylase" amino acids 3 to 269 (267 residues), 262.1 bits, see alignment E=3.3e-82 PF02086: MethyltransfD12" amino acids 8 to 254 (247 residues), 209.8 bits, see alignment E=2.9e-66

Best Hits

Swiss-Prot: 50% identical to DMA_SALTI: DNA adenine methylase (dam) from Salmonella typhi

KEGG orthology group: K06223, DNA adenine methylase [EC: 2.1.1.72] (inferred from 48% identity to esa:ESA_04355)

MetaCyc: 50% identical to DNA adenine methyltransferase (Escherichia coli K-12 substr. MG1655)
Site-specific DNA-methyltransferase (adenine-specific). [EC: 2.1.1.72]

Predicted SEED Role

"Methyl-directed repair DNA adenine methylase (EC 2.1.1.72)" in subsystem DNA repair, bacterial (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>LU632_RS01520 Dam family site-specific DNA-(adenine-N6)-methyltransferase (Erwinia tracheiphila SCR3)
MIRSLLKWPGGKTRVIPELLPYLPKANCLVEPFVGGASVFLNTDYRRYILADINPDLIRL
YREVKGNPDLLTGMARQLFAEGNSKEAYLRNRHIFNSVKGLPDVYRAALFLYLNRHGYNG
VVRYNQRGGYNVPFGQHKTAPYFPETEIRQFAEKANDTKAIFLCSSFQNTLKVMAGTDEA
IYCDPPYLPVSETASFTQYHTEPFTGKHHRQLVAELLEVNRKYGAPVVISNSDTETTREI
YQLFRMHEISVQRSVSTDASNRQRAREVIGTLGTHAESQV