Protein Info for LU632_RS01115 in Erwinia tracheiphila SCR3

Name: mtnA
Annotation: S-methyl-5-thioribose-1-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase
  • amino acids 8 to 327 (320 residues), 402.5 bits, E=1.2e-124
• TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins
  • amino acids 36 to 328 (293 residues), 307.5 bits, E=8.8e-96
• PF01008: IF-2B
  • amino acids 48 to 328 (281 residues), 232.5 bits, E=3e-73

Best Hits

Swiss-Prot: 81% identical to MTNA_ENT38: Methylthioribose-1-phosphate isomerase (mtnA) from Enterobacter sp. (strain 638)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 89% identity to ebi:EbC_08740)

MetaCyc: 78% identical to 5-methylthioribose-1-phosphate isomerase monomer (Klebsiella pneumoniae)
S-methyl-5-thioribose-1-phosphate isomerase. [EC: 5.3.1.23]

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

• 5'-deoxyadenosine degradation II (2/4 steps found)
• 5'-deoxyadenosine degradation I (1/3 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (1/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (1/5 steps found)
• L-methionine salvage cycle III (5/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (5/12 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (1/7 steps found)
• L-methionine salvage cycle II (plants) (3/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Protein Sequence (343 amino acids)

>LU632_RS01115 S-methyl-5-thioribose-1-phosphate isomerase (Erwinia tracheiphila SCR3)
MQTLSTTSLQVRDNQLWILDQQALPQKKIWCATPDVAELVGHIKALRVRGAPLIGLSASL
LLALLAENGMPHPTLADALEILRAARPTAVNLMNNLDRMKQALAQRDFVSALTVEALRLV
AEDKALCDSIATAGSALIKPGSRLLTHCNTGGLATAGTGTALGVISRGWQEGNVAQVWVD
ETRPLLQGGRLTAWELGELGIPYRLICDSMAASLMAQKQVDAIWVGADRISANGDVANKI
GTYSLAVLAHYHGIPFYVAAPRTTFDPHCPTGNAIPIEQRDASEVTGVAGSFGKVQWAPE
GAQVFNPAFDVTPAALISGWVLDTGVVLPSAVNNGIFGLPHQG