Protein Info for LU632_RS01060 in Erwinia tracheiphila SCR3

Annotation: IS256 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF00872: Transposase_mut" amino acids 14 to 377 (364 residues), 361.7 bits, see alignment E=2.1e-112

Best Hits

Swiss-Prot: 48% identical to Y4PO_SINFN: Probable transposase for insertion sequence element ISRM3-like (NGR_a01970) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 89% identity to esc:Entcl_1070)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>LU632_RS01060 IS256 family transposase (Erwinia tracheiphila SCR3)
MDEKKLKALAAELAKGLKTEADLNQFSRMLTKLTVETARNAELTDHLGHEKNAPKTCTNT
RNGYSSKTLLCDDGEIGLNTPRDRENTFEPQLIKKNQTRIAQMDSQILSLYAKGMTMREI
VDTFKEMYDADVSPALISKVTDAVKEQVAEWQNRQLDALYPIVYLDCIVVKVRQNGSVIN
KAVFLAPGINTEGRKELPGMWLAENEGAKFWLNVLTELKNRGLQDILIACVDGLKGFPDA
INSVYLQTHIQLCIIHMVRNRLKYVAWKDYKAVTGGLKTVYQAPTEAAARMALDAFAEEW
DDKYPQISKSWRAHGENLNTFFGYPSDIRKAIYTTNAIESLNSVIRDAIKKRKVFPTDDA
VKKEVWLAIQAASQKWRMPLRDWRMAMSRFIIGLGDRPDGHY