Protein Info for LU632_RS00115 in Erwinia tracheiphila SCR3

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 247 to 263 (17 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 309 to 333 (25 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 4 to 102 (99 residues), 36.5 bits, see alignment E=4e-13 PF01757: Acyl_transf_3" amino acids 8 to 326 (319 residues), 83.7 bits, see alignment E=1.3e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>LU632_RS00115 acyltransferase (Erwinia tracheiphila SCR3)
MRARIQHLDGMRGLAILLVIGFHACARWPEKLHFVASTKDFPLFAYGYLGVPLFFMISGF
VIFMTLDKSESYRSFLQKRWIRLFPAMLIASVLIYLTAGLFPERPAGSPTLINLIPGLLF
INPETLSMASGINFASLEGSFWSLYVEVVFYLLIGFVYYFVGRKYCLPALILPMLAVSAA
SAIKMLGHPLLADVISKFGFIHYSWFMIGCLVYERMHQRDKLYHYGLTLLAILINLSFYI
KTRGLDVLFPLALAFLLFVFSFYSTRLEKVLSVSFLRSIGYASYTLYLIHENLLIATLIK
LNHYINNDYIMLLMTIPVVALLYFVAWQLTCYVEPAVRRVFKREHRQPQTD