Protein Info for LRK53_RS18835 in Rhodanobacter sp000427505 FW510-R12

Annotation: TraB/VirB10 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details PF03743: TrbI" amino acids 228 to 421 (194 residues), 124.1 bits, see alignment E=3.2e-40

Best Hits

Predicted SEED Role

"IncF plasmid conjugative transfer pilus assembly protein TraB" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>LRK53_RS18835 TraB/VirB10 family protein (Rhodanobacter sp000427505 FW510-R12)
MELNPRKRWEALSATHKQYVVWGVGVAMLMLLGTFIFGSPSPRASAPGAVKTRMANELMP
AGAARDLGVTGLATGLAEQARDQKQLAQSVDKLREQQEAQRHHRENSAERESAQRTQEEL
AELRRQIQAMQQGGVPAATPAASAAPVAPSTGDLAPMAGSSPAQPLRPTGAASGGIREIG
VSVPADAASDAPSGMSTRPAVPSVPGTAASRGDDKPASAPDTSVPTMYLPSGSMMQVVSI
TGMDAPTGRQAMKDPLPMLFRVKASAVLPNRYRADVRECFVVASGHGDLASERAYLRSTN
ISCIRRDKRVIDVPVEMVAIGPDGKAGIRGRLVSKQGQIIAKAAAAGVMQSIAQAFSGSN
YRLNFGAEQQDYGQALQQGVGGGVGSAFDRIAKYYLDMADQMFPVVEVDAGQKVTFMLVK
GAQMGVVK