Protein Info for LRK53_RS17875 in Rhodanobacter sp000427505 FW510-R12

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 309 to 334 (26 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details PF07690: MFS_1" amino acids 2 to 218 (217 residues), 50.8 bits, see alignment E=1.3e-17 amino acids 225 to 396 (172 residues), 34.3 bits, see alignment E=1.3e-12 PF13000: Acatn" amino acids 6 to 154 (149 residues), 25.9 bits, see alignment E=3.8e-10

Best Hits

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 50% identity to gpb:HDN1F_28080)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>LRK53_RS17875 MFS transporter (Rhodanobacter sp000427505 FW510-R12)
MALFGFSSGLPFLLVAGTLAYWLKENGIKLADITMIASAGMTYAFKFVWAPLLDHGRLPG
FARLGQRRGWLLFAQLGVVFGLLAMAALTPRQLTPFVAATLLVAFFGATQDIAVDAYRIE
IAPIEAQGALVATYSLGYRIGLLLAGAVALILADHLSWRLVYVLMALAMAVPVATTLIAR
EPDVLRVRATRWRDAMRESVIDPFADFFRRYGWPLAGVTLLFLLLFKMPEQATIGGIMSP
FYRDMGFSKTQIGTITKIYGIWIGIVGVFIGGAMVARWGAWRPLGITIVLCGCSNLLYLL
LIAHPGDLLVLTLVISGENLTLGMLGPPTVAFLSSLVNRQHTATQYALLSSLVNLPGKLL
GFFAGGIATATGYGGYFVITVLAVLPSMLLFAGLWRYFRGEERARAAAGAA