Protein Info for LRK53_RS17865 in Rhodanobacter sp000427505 FW510-R12

Annotation: anhydro-N-acetylmuramic acid kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF03702: AnmK" amino acids 7 to 369 (363 residues), 460.8 bits, see alignment E=1.8e-142

Best Hits

Swiss-Prot: 58% identical to ANMK_XANAC: Anhydro-N-acetylmuramic acid kinase (anmK) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 55% identity to xal:XALc_0381)

MetaCyc: 48% identical to anhydro-N-acetylmuramic acid kinase (Escherichia coli K-12 substr. MG1655)
RXN0-4621 [EC: 2.7.1.170]

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>LRK53_RS17865 anhydro-N-acetylmuramic acid kinase (Rhodanobacter sp000427505 FW510-R12)
MDDASALYIGLISGTSADGIDAVLTSFNRGLPQLQASHSHPWPADLRRRMLALAQGESAL
DLDAFGRLDVQIGRCFADAALQLLERSGTPTSAVRAIGSHGQTLRHRPSGAYPFTLQLGD
PSVIAERCGIDVVADFRRADVAAGGQGAPLLPALHAMLLARPGHVRVVLNLGGIANITVL
GADGRVFGFDTGPANGLLDAWHLRQHGEPFDRDGAYAARGRVDTGLLDTLLADPYFTLPP
PKSTGREYFHLDWLAAHAPLAALDPADVQATLLELTARSVAAAIAQHAPQAEEVLACGGG
VHNGALMRRLGELLAPRVLLDTSRYGVDPDFLEATAFAWLARQRLLGLPGNLPAVTGARG
PRILGAVYSAPVAPPA