Protein Info for LRK53_RS17790 in Rhodanobacter sp000427505 FW510-R12

Annotation: lytic murein transglycosylase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13406: SLT_2" amino acids 37 to 323 (287 residues), 298.9 bits, see alignment E=1.9e-93 TIGR02282: lytic murein transglycosylase B" amino acids 38 to 325 (288 residues), 328.7 bits, see alignment E=1.4e-102

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 45% identity to cja:CJA_0791)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>LRK53_RS17790 lytic murein transglycosylase B (Rhodanobacter sp000427505 FW510-R12)
MTVAPVPSAARFLAILLVLWMGASTPATATTHPGQAELVREVARETGKSPQALNALLDGA
KRQQAILDAISRPAEAKPWKDYRPIFLTDERINDGIAFYRAHRALLEQVGKQYGVAPEYI
VAIVGVETSYGRNTGKYKVLDALVTLGLYYPPRATFFRAQLKELLSLPDNHLAGPVDTLT
GSYAGAQGWGQFMPTSIRDFAVDADHDGHIDLSNSLPDIFASVANYFVRHGWIAGGPVAA
QAQPDGAAKPIAVKDATPQWPLEQLVAWGYAPLQHLPPGEPASLQTLDGPNGPEYWFTFQ
NFYVITRYNRSPLYALAVDQLAQAIAAGADPAEVTR