Protein Info for LRK53_RS17765 in Rhodanobacter sp000427505 FW510-R12

Annotation: lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16881: LIAS_N
  • amino acids 42 to 80 (39 residues), 32.4 bits, 1e-11
• TIGR00510: lipoyl synthase
  • amino acids 42 to 325 (284 residues), 452.9 bits, E=2.7e-140
• PF04055: Radical_SAM
  • amino acids 95 to 261 (167 residues), 96.1 bits, E=2.8e-31

Best Hits

Swiss-Prot: 80% identical to LIPA_XANC5: Lipoyl synthase (lipA) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 75% identity to xal:XALc_0817)

MetaCyc: 68% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
• lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.8

Use Curated BLAST to search for 2.8.1.8

Protein Sequence (333 amino acids)

>LRK53_RS17765 lipoyl synthase (Rhodanobacter sp000427505 FW510-R12)
MSAPSPKIIPLAVVSGAPAGEKQLGNDKIALNRAGFDTGAPTLRKPSWIRVRLPQGNAVQ
QLKARLRENSLVTVCEEASCPNIHECFSKGTATFMILGEVCTRRCSFCDVAHGRPVAPDP
LEPARLAETIADMRLKYVVITSVDRDDLRDGGAEHFAACIRATRHASPHIRIEILTPDFR
GKGRMERALEVLKDFPPDVFNHNLETVPHLYREVRPGADYQWSLDLLKRFKAQHPQVPTK
SGVMLGLGETMEQVLETMRDLRAHDVEMITIGQYLQPTPHHHPVLRYWRPEEFDALRAEG
EAMGFHHVASGPLVRSSYHADLQAHAAGVTESA