Protein Info for LRK53_RS17435 in Rhodanobacter sp000427505 FW510-R12

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07715: Plug" amino acids 65 to 161 (97 residues), 70.4 bits, see alignment E=3.4e-23 TIGR01783: TonB-dependent siderophore receptor" amino acids 67 to 711 (645 residues), 319.7 bits, see alignment E=2.3e-99 PF00593: TonB_dep_Rec_b-barrel" amino acids 234 to 682 (449 residues), 212 bits, see alignment E=6.1e-66 PF25183: OMP_b-brl_4" amino acids 326 to 498 (173 residues), 30.9 bits, see alignment E=2.1e-11 PF14905: OMP_b-brl_3" amino acids 422 to 696 (275 residues), 27.4 bits, see alignment E=3.5e-10

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 49% identity to pzu:PHZ_p0219)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (713 amino acids)

>LRK53_RS17435 TonB-dependent siderophore receptor (Rhodanobacter sp000427505 FW510-R12)
MSNPNPLTAALAAALLLAFAPPVVAGSASGPEQATNLKPVNVRAASVDGYAAAGTDTATR
TRSLLRDIPQSITVVTGDLIRDLAMTSMADAVRYMPGVGMGQGEGHRDAPILRGNGSTAD
LFIDGMRDDVQYFRDLYNIERVEALKGPNAMIFGRGGSGGVLNRVSKAADGQQHRELSLQ
LGEQQRRRLTADFGEPVGDSAAFRVTGLYEDSGSYRDGVTLKRYGINPTLALRAGERTQV
TLGYEHFRDERVTDRGVPSYRGLPLPTAASTFFGDPRQSPTWVTVDAFNALVDHDFGNGV
SLRNRTRYADYDKFYQNVFPGAVNAAGTQVSISAYSNATRRRNLFNQTDLTYELVTGAVH
HTLLGGLELGRQSTDNFRRTGYFGGPAFAGTSARVPVSDPRYTLPVDFRQSATDPSNHGI
AKVAALYLQDQIEFSPQWQAVLGLRYDRFTVDFHDHRSGQDFSSTDNLVSPRAGLVYKPV
EPLSLYASYSIAHQPRAGEQLTSLTLGNRTLEPERFTNRELGAKWDVSPALALTAAVYRL
DRSNVAVTNPAWDPATNPGVPQSLLVDGQRIKGVELGFSGRLTSAWSVMGGYAWQEGEIT
RPLSPSLPAGTRLAQLPKHSASLWNRYDFTPMWGAGIGAIHQGSVFASTSNKVTLKGYTR
YDAAVFLTLSPQLRLQLNVENLFDKRYFVSAHNDNNITPGSPRAFYLGVNVRL