Protein Info for LRK53_RS17280 in Rhodanobacter sp000427505 FW510-R12
Annotation: iron transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to Y885_BRUME: UPF0423 protein BMEII0885 (BMEII0885) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
KEGG orthology group: K07230, (no description) (inferred from 73% identity to dar:Daro_1113)MetaCyc: 63% identical to ferrous iron uptake system, iron-binding protein FtrA (Brucella abortus 2308)
Predicted SEED Role
"Periplasmic protein p19 involved in high-affinity Fe2+ transport" in subsystem Campylobacter Iron Metabolism or Transport of Iron
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (180 amino acids)
>LRK53_RS17280 iron transporter (Rhodanobacter sp000427505 FW510-R12) MSCVRSAVVTLVALTALAAQPARAVEYPIGTPQQRDGMEIAAVYLQPIEMEPEGMMRPAK DSDVHMEADIHALANNPNGFDEGAWMPYLTVKYEITRQGSTQRLDGDFMAMVASDGPHYG DNVKLMGPGKYHVKFTIYPPSTATHFGRHTDRLTGVRPWFKPFVVENDFTYVGIGKKGGY