Protein Info for LRK53_RS17200 in Rhodanobacter sp000427505 FW510-R12

Annotation: oxygen-independent coproporphyrinogen III oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 TIGR00538: oxygen-independent coproporphyrinogen III oxidase" amino acids 9 to 466 (458 residues), 558.8 bits, see alignment E=4.7e-172 PF04055: Radical_SAM" amino acids 62 to 237 (176 residues), 84.5 bits, see alignment E=1e-27 PF06969: HemN_C" amino acids 372 to 441 (70 residues), 41.7 bits, see alignment E=1e-14

Best Hits

Swiss-Prot: 55% identical to HEMN_CUPNH: Oxygen-independent coproporphyrinogen III oxidase (hemN) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 59% identity to psu:Psesu_0365)

Predicted SEED Role

"Coproporphyrinogen III oxidase, oxygen-independent (EC 1.3.99.22)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.99.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>LRK53_RS17200 oxygen-independent coproporphyrinogen III oxidase (Rhodanobacter sp000427505 FW510-R12)
MAIPIVPPEFDPALIARYDVAGPRYTSYPTAPHFKAEFDEAALRAVIRASNEEPIPRPLS
VYVHVPFCMSPCFYCGCNRVITRDVTQADRYLERLYREIELIAPLFDRDRPVRQLHFGGG
TPNFLDTAHMGELLESLARHFSFSHAADREYGIEIDPRFADAAYIRAMGELGFNRISVGI
QDFDPVVQKAVNRIQSFEQTREVIEAARASGFRSASVDLIYGLPFQSVDGFSRTLDQVVA
LNPDRVAVYGYAHLPEMFKAQRQIEAADLPDATTRLALFGRALEHLSAAGYVYIGMDHFA
KASDELVLAQRAGTLQRNFQGYSTHGDCDIVGLGVSAIGRIGDSYSQNARDLIGYYATLD
AGRLPLMRGLQLDEDDLIRRELINELMCHGSVDKQAFGARHRLLFDEYFARERQRLVPLV
EDGLVTENPREIRVTSRGRLLLRIIAMCFDAYLDDAAQAPRYSRVI