Protein Info for LRK53_RS17140 in Rhodanobacter sp000427505 FW510-R12

Annotation: S1/P1 nuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02265: S1-P1_nuclease" amino acids 24 to 270 (247 residues), 188 bits, see alignment E=1.5e-59

Best Hits

KEGG orthology group: K05986, [EC: 3.1.30.1] (inferred from 50% identity to xcc:XCC3198)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.30.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>LRK53_RS17140 S1/P1 nuclease (Rhodanobacter sp000427505 FW510-R12)
MSLRRCSLAFAAILLVVAPATRAWGPLGHRVVAELAQRHLGPAAGAELERLLAAEHTTQL
ADVAGWPDQIQNDPAQATLWQQTRKLHYVNFRGGPGCDYEPPRDCRNGACIVAGLRRYVA
ILGDKAQSDAARLEALKFVVHFAGDIHQPLHAGYRDDLGGNRYQVQFEGKGSNLHRVWDT
GMLETRGLGWQAYAAKLDAEGLAPLPPPIAPLDDPYAPWARESCHATAAPGFYPDGHRIG
QAYVDAELPVAENQLRIGGRRLAAVLNLALTPR