Protein Info for LRK53_RS17100 in Rhodanobacter sp000427505 FW510-R12

Annotation: proteobacterial dedicated sortase system response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR03787: proteobacterial dedicated sortase system response regulator" amino acids 3 to 228 (226 residues), 361.5 bits, see alignment E=8.4e-113 PF00072: Response_reg" amino acids 5 to 116 (112 residues), 74.8 bits, see alignment E=6.3e-25 PF00486: Trans_reg_C" amino acids 154 to 226 (73 residues), 50.3 bits, see alignment E=2e-17

Best Hits

Swiss-Prot: 36% identical to REGX3_MYCS2: Sensory transduction protein regX3 (regX3) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 61% identity to cps:CPS_3982)

Predicted SEED Role

"DNA-binding response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>LRK53_RS17100 proteobacterial dedicated sortase system response regulator (Rhodanobacter sp000427505 FW510-R12)
MGRSIAIVEDEPLIRANYVEALNRFGYDARGYGSRREASGAFAMRLPELVIIDIGLGDEP
EGGFDLCRELRAKSATLPIIFLTARDSDFDVISGLRLGADDYLSKDTSLHQLAARIAALF
RRIESLKVPASSETVIEHGPLKLESERMRITWNGEEIPLTVTEFWMVHTLIRFPGHVKNR
DQLMREAELVVDDATITSHIKRIRKKFIAVAPEFDAIETVHGVGYRWKP