Protein Info for LRK53_RS17080 in Rhodanobacter sp000427505 FW510-R12

Annotation: efflux transporter outer membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 transmembrane" amino acids 51 to 67 (17 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 87 to 559 (473 residues), 434.5 bits, see alignment E=2.4e-134 PF02321: OEP" amino acids 153 to 329 (177 residues), 48.2 bits, see alignment E=5.8e-17 amino acids 376 to 557 (182 residues), 96.4 bits, see alignment E=1e-31

Best Hits

KEGG orthology group: None (inferred from 55% identity to rme:Rmet_5328)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein, NodT family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (593 amino acids)

>LRK53_RS17080 efflux transporter outer membrane subunit (Rhodanobacter sp000427505 FW510-R12)
MRLDEQACASDPVVASTSLNAISCRVLRRIGTLYRCVSDLLAKTRPHERPVVRVLAGTVD
MMAAMIGRARSLRSTAWLPLWRLLAAVVVLGLAGCAVGPDFQRPAAPAVGRLTAAPLPTT
TAGADVAGGQPQRFVLDADIPAQWWTLFHSAELNALIEQSLAHNSDLKAAQAALAVAHEN
ARAQRGAYYPAVNAGFSATRQKQSQQVAPGPNYPVVPQEYLYSFFTPQLSISYAPDLFGL
NRRTVESLQAQEQSVRFQMIAARITLSTNVVAAAVQQASLREQIAASRELIAIDSKMVDI
LRYQLAKGYAGRLDLAAQESQLAQLQATLPPLLTRLDQQNDLLAVLAGRLPSGAPAPAFD
LASLHLPQQLPLSLPSRLVAQRPDVRQAEANMHAASANIGVAIANRLPNVSLTANAGSTA
VAIGQVFKSGTGFWGIGADIAAPIFHGGSLLHQERAAKAAYVQASEQYRSTVLTAFQNVA
DTLAALQHDAEGLQAASSAAQAAKLTLDLSQRQYKDGYAGYLSLLGAEQGYQQARIALVQ
AQASRYADTAALFQALGGGWWNAADGAQAHSAATQPRPSDSDHAKADRDSDEK