Protein Info for LRK53_RS17075 in Rhodanobacter sp000427505 FW510-R12

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF16576: HlyD_D23" amino acids 54 to 294 (241 residues), 152.1 bits, see alignment E=2.8e-48 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 63 to 367 (305 residues), 156.5 bits, see alignment E=4.3e-50 PF13533: Biotin_lipoyl_2" amino acids 76 to 111 (36 residues), 25.8 bits, see alignment 1.4e-09 PF13437: HlyD_3" amino acids 192 to 285 (94 residues), 57.1 bits, see alignment E=5.5e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>LRK53_RS17075 efflux RND transporter periplasmic adaptor subunit (Rhodanobacter sp000427505 FW510-R12)
MAFALALGAVLAAAGCSSRSEAQHAAASDTPQNVTMTPAQRQRIHLFTVAPASFHRAIET
TGVVDFDNDQATGVLAPFSGPVLRVLVAPGDQVHQGQPLALVDSPDFAAAIGAYRKALAS
ARNARKLADTDQDLLQHQGVSRREAEQAQTDAASAEADRDAALQALVALHVDAGTIEAIQ
SGRTVARTQGIIRAPVAGTVVEKLISPGQLLQAGTTPCFTVADLSKVWVMAQVTAAELAG
IRVGDPAQAEAAAGGELAGTLDNIAAVVNPNTRAIAARIVVPNPQGALRKQMYVRVRIQS
RQASKGLLVPASALLRDDDNLPFVYLAQADGSFARRHVTTGSRTGDDYLVSDGLRPGDRI
VVDGGIFVQFMQNQ