Protein Info for LRK53_RS17040 in Rhodanobacter sp000427505 FW510-R12

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 TIGR01048: diaminopimelate decarboxylase" amino acids 25 to 425 (401 residues), 465.4 bits, see alignment E=6.6e-144 PF01168: Ala_racemase_N" amino acids 47 to 242 (196 residues), 30.9 bits, see alignment E=3.4e-11 PF02784: Orn_Arg_deC_N" amino acids 48 to 294 (247 residues), 202.7 bits, see alignment E=9.5e-64 PF00278: Orn_DAP_Arg_deC" amino acids 256 to 383 (128 residues), 93.7 bits, see alignment E=1.1e-30

Best Hits

Swiss-Prot: 49% identical to DCDA_PSEAE: Diaminopimelate decarboxylase (lysA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 50% identity to azl:AZL_d01130)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>LRK53_RS17040 diaminopimelate decarboxylase (Rhodanobacter sp000427505 FW510-R12)
MPTQTTNRPAAQETARETDGAPGMFDGVDLRQLAERIATPFHAYSASAIRQRIDELQAAL
AGLDAAICFAVKANPNLAILQLMANAGVGADIVSVGELRRALNAGIPAERIVFSGVGKSA
DEIAGALNVGIMHFNVESLDELHTLQRLAKAQEVTARAAMRINPDVDAQTHARISTGKSE
NKFGVSIDEARRWFAGRKALTHVQLDGLHVHIGSQILSLDPFRLALQRVAAFWRELEQAG
HPVNSIDVGGGLGVCYRAGVDRPLAATDYVGVIRAALAGFRGRLLLEPGRWLVAEAGVLL
TRVLRIKQGAERRFLVLDAAMNDLQRPSLYDAWHDIVPVADEPRPPATYDIVGPVCETGD
TFARARELPECSAGDLLLIRATGAYGASMASSYNSRTLAAEVLLDQGRYAVVRRRQHFEE
MIAGEQPARNWETA