Protein Info for LRK53_RS16980 in Rhodanobacter sp000427505 FW510-R12

Annotation: haloacid dehalogenase-like hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 39 to 56 (18 residues), see Phobius details PF12710: HAD" amino acids 14 to 191 (178 residues), 74 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: None (inferred from 41% identity to cwo:Cwoe_3743)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>LRK53_RS16980 haloacid dehalogenase-like hydrolase (Rhodanobacter sp000427505 FW510-R12)
MTEGERVAASPRVVLFDFDGVLIRGDTFRQFVRERYRRSPWRCALALLCSPLLLAQRPFS
RRLPLYTLVRIALLGLGEQRYRAAADAFAAMLARRPKQFCRDGLQALRRHQLAGDRVLVV
TGCEHTLASGILQQLGLTGLEVLASQLRPGWLGMRLLRHNVGRRKVQSLTEYGVGGWQVA
YGDSMHDAAMLALAAEAVLVNGTPKLCKKIEKALGRAVTRVEWF