Protein Info for LRK53_RS16970 in Rhodanobacter sp000427505 FW510-R12

Annotation: cAMP-activated global transcriptional regulator CRP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00027: cNMP_binding" amino acids 39 to 126 (88 residues), 69.6 bits, see alignment E=2.8e-23 PF13545: HTH_Crp_2" amino acids 166 to 229 (64 residues), 41.5 bits, see alignment E=1.6e-14 PF00325: Crp" amino acids 189 to 220 (32 residues), 37.9 bits, see alignment 1.8e-13

Best Hits

Swiss-Prot: 58% identical to CLP_XANAC: CRP-like protein Clp (clp) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K10914, CRP/FNR family transcriptional regulator, cyclic AMP receptor protein (inferred from 60% identity to psu:Psesu_0327)

Predicted SEED Role

"Cyclic AMP receptor protein" in subsystem CytR regulation or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>LRK53_RS16970 cAMP-activated global transcriptional regulator CRP (Rhodanobacter sp000427505 FW510-R12)
MIVAQLKYQLQQAFERSQAPLGFAPDPAAMERFLALCHRRRYPGKTAIIRPGDPANTLYY
VIDGSLAVCTEDEQGRELILAYISRGQFIGEMGLFVEQAQRESMVRTRAPCEMAEVSYER
LFQLMEGPLREECPKILFAIGSQLTNRLLRTSRQVSRMAFMDVTNRISRTLLDLCQEPDS
MTHPDGTQIRISRQEVSRIVGCSREMVGRVLKQLEEQRMIDVSGKTIVVRGTR