Protein Info for LRK53_RS16580 in Rhodanobacter sp000427505 FW510-R12

Annotation: drug/metabolite exporter YedA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details PF00892: EamA" amino acids 25 to 153 (129 residues), 80.4 bits, see alignment E=8.1e-27 amino acids 163 to 297 (135 residues), 70.3 bits, see alignment E=1e-23

Best Hits

Swiss-Prot: 49% identical to YEDA_ECO57: Uncharacterized inner membrane transporter YedA (yedA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 58% identity to psu:Psesu_2666)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>LRK53_RS16580 drug/metabolite exporter YedA (Rhodanobacter sp000427505 FW510-R12)
MSDTAASIAAARPRRLADPGLLIPLALLALYVIWGSTYLGIRFALESWPPFLLAGVRFLG
AGVALYGFLRWRGMAPPTREQWRNAAVVGLLLLGLGNGLVCFAEQRVSSGIAAVAVASMP
LFAALFSGMYGEWPHRRESIGLAIGFAGVIVLNLGSSLAGSSIGAAALLVAAAAWAFGSV
WSRRQAMPPGPMNTAAQMICGSAALLGFALLSGERLPVHPTVRSTLAIVYLAVFGSIIAF
STYLYVLRHARPALATSYAYVNPPVAVLFGVLLAGEHVGPFDLAGMAIILAGVAVITLAK
QKR