Protein Info for LRK53_RS16530 in Rhodanobacter sp000427505 FW510-R12

Annotation: 30S ribosomal protein S6--L-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF18030: Rimk_N" amino acids 1 to 94 (94 residues), 132.8 bits, see alignment E=1.1e-42 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 2 to 284 (283 residues), 263.4 bits, see alignment E=1.2e-82 PF02655: ATP-grasp_3" amino acids 97 to 263 (167 residues), 32.6 bits, see alignment E=2.1e-11 PF08443: RimK" amino acids 97 to 285 (189 residues), 199 bits, see alignment E=1.4e-62 PF02955: GSH-S_ATP" amino acids 138 to 265 (128 residues), 52 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 69% identical to RIMK_XANOM: Probable alpha-L-glutamate ligase (rimK) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

KEGG orthology group: K05844, ribosomal protein S6 modification protein (inferred from 69% identity to xop:PXO_02302)

MetaCyc: 60% identical to ribosomal protein S6 modification protein (Escherichia coli K-12 substr. MG1655)
6.3.2.-

Predicted SEED Role

"Ribosomal protein S6 glutaminyl transferase" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>LRK53_RS16530 30S ribosomal protein S6--L-glutamate ligase (Rhodanobacter sp000427505 FW510-R12)
MKIAILSRNTRLYSTKRLVEAARVRGHVVRVFDPLRCYVRVAPGASSIRYKGREVRDIDA
VIPRIGTTSTFYGTAVLRQLEMMGVYTPNPSDAVLRARDKLRCLQILAAQGIDMPVTVFG
DNPDDADDVLALLGDPPHVIKLNEGSQGTGVVLAEKRAASQSVIEAFRGLYANFLVQEFV
AEAKGSDLRCFVVGKKVVAAMQRDATPGDFRANLHRGGTAMAATLSVEEKRIAVRAAGAL
GLGIAGVDLLRSKRGPLLLEVNASPGLEGIEAATGVDVAGAVVELLEAQAREVPAETRPH
RKPVRA