Protein Info for LRK53_RS15965 in Rhodanobacter sp000427505 FW510-R12

Annotation: (2Fe-2S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF01799: Fer2_2" amino acids 96 to 168 (73 residues), 76.9 bits, see alignment E=5.4e-26

Best Hits

Swiss-Prot: 46% identical to NICA_PSEPK: Nicotinate dehydrogenase subunit A (nicA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07302, isoquinoline 1-oxidoreductase, alpha subunit [EC: 1.3.99.16] (inferred from 54% identity to rsc:RCFBP_11442)

MetaCyc: 46% identical to nicotinate hydroxylase small subunit (Pseudomonas putida KT2440)
NICOTINATE-DEHYDROGENASE-RXN [EC: 1.17.2.1]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.17.2.1 or 1.3.99.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>LRK53_RS15965 (2Fe-2S)-binding protein (Rhodanobacter sp000427505 FW510-R12)
MARVQAQVLSTAQESGVVAEKIRDGIDLEVNGERFRHTGDPQMPLLWYLRDVLRLTGTKY
GGEAGENGADLVLVDGKAVSAIMQPLARLAGKAVTTVEGLAANDGSLHPLQQAFIDEDAI
GCGYCTPGWLIAGIDLLRRKPQPDDGDIDQLPNLCRCGCQTRVRRAIKRAAAGKAARA