Protein Info for LRK53_RS15960 in Rhodanobacter sp000427505 FW510-R12

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 329 to 347 (19 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 384 to 406 (23 residues), see Phobius details amino acids 412 to 430 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 13 to 404 (392 residues), 180.7 bits, see alignment E=4.8e-57 PF00324: AA_permease" amino acids 18 to 372 (355 residues), 131 bits, see alignment E=5.3e-42

Best Hits

Predicted SEED Role

"amino acid permease-associated region"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>LRK53_RS15960 amino acid permease (Rhodanobacter sp000427505 FW510-R12)
MNDASPGYVRSLRPWDAALIVVGGVIGGGIFLNPGIVAQRTESGLALLLMWVAAGLLTLV
GALCYAELGARRPRAGGSYVYLREAFGPLAGFLFGWTMLLVIYSGSTAAVATIFARYAAA
LFGLPAAWTLPLAVGALVFVSGINLFGIRLGAQVQNLFALLKLLAVAALVGCGLFLAGAG
HGQVLAADPARQDVGFMGAALPVLFAYSGFTYLNNLAGEVRDPQRTLPRALTLGMLLVIG
AYALVNVAYLAVLGHAGLAASSAPAADVMQQVAGPLGAKLIALGVAISTLGFCNITLVAG
ARVLQVMGEDGLFFRAVARLHPRWRTPNTALLLLSGWAIVLALSGSYGQLLDYATFGDWL
ACAIGVATLFWYRRHDAVSGGFRVPGYPWLPLLFVAAVTLVVLLSLRDNPRNTGIGLLIM
LAGVPVYALWRRLFSRTRP