Protein Info for LRK53_RS15935 in Rhodanobacter sp000427505 FW510-R12

Annotation: UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 10 to 435 (426 residues), 332 bits, see alignment E=3.3e-103 PF21799: MurD-like_N" amino acids 10 to 95 (86 residues), 27.4 bits, see alignment E=5.2e-10 PF08245: Mur_ligase_M" amino acids 115 to 276 (162 residues), 64.5 bits, see alignment E=2e-21 PF02875: Mur_ligase_C" amino acids 299 to 413 (115 residues), 33.3 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 51% identical to MURD2_XYLFA: UDP-N-acetylmuramoyl-L-alanine--L-glutamate ligase (murD2) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 53% identity to smt:Smal_1013)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>LRK53_RS15935 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Rhodanobacter sp000427505 FW510-R12)
MRIAELADRRVAIWGFGREGHAVIKALRAYLPAQTLTLFCNAAEVEAARAFDPALDIVAG
EPDAATLSRFDVVVKSPGISAYKPALLAAQAQGTRFTSGTALWFGENPDARVIAVTGTKG
KSTTSALIAHLARALGVRTALAGNIGLPLLELLDQRAELWVIELSSFQTGEAGPLELGVV
TSLYEEHLDWHGSRERYVADKLKLADASRTLLVNGLQPGLLERTAAHPRRLLFGTLEGWH
ISDGFICRGAQAVFPIGQLAAPGLHNALNACAALAALEAVGMDALAAAPALATFRPLPHR
LQPLGERNGWHWVNDSISTTPLATLAALESLHGRTVTVLVGGHDRGLDWTPFVEAMRAVP
AHAIVCMGANGARIEAALRSAEVACSILLVANLASAVEVARARTPAHGVILLSPGAPSFD
QFKDYAERGRRFSALAGFDSSRIASIDGLGIEGTPRD