Protein Info for LRK53_RS15780 in Rhodanobacter sp000427505 FW510-R12

Annotation: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR03725: tRNA threonylcarbamoyl adenosine modification protein YeaZ" amino acids 3 to 217 (215 residues), 204.9 bits, see alignment E=7.6e-65 PF00814: TsaD" amino acids 28 to 151 (124 residues), 102.4 bits, see alignment E=1.8e-33

Best Hits

Swiss-Prot: 44% identical to TSAB_VIBPA: tRNA threonylcarbamoyladenosine biosynthesis protein TsaB (tsaB) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K14742, hypothetical protease [EC: 3.4.-.-] (inferred from 58% identity to xac:XAC3106)

Predicted SEED Role

"TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>LRK53_RS15780 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB (Rhodanobacter sp000427505 FW510-R12)
MNLLAIETATEACSVALIHGDELIARSEIAPRRHTELVLPMADELLAEAGIGRRALDAIA
VGRGPGAFTGVRLAVSLAQGMALALDLPVVTVSSLAALALEAPEEEGTAILAVIDARMGE
IYAACYRRDGADGLLALDDERICTAETLVLPEARAWQVVGSGWATYATALSQRLTGPLRS
ADGLRYPQAVHVAELAVREFKAGRALPPEQALPVYLRDKVALTLVEQGKA