Protein Info for LRK53_RS15705 in Rhodanobacter sp000427505 FW510-R12

Annotation: RNA polymerase factor sigma-54

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 PF00309: Sigma54_AID" amino acids 5 to 48 (44 residues), 55.9 bits, see alignment 4.7e-19 TIGR02395: RNA polymerase sigma-54 factor" amino acids 9 to 482 (474 residues), 470.3 bits, see alignment E=3.4e-145 PF04963: Sigma54_CBD" amino acids 118 to 312 (195 residues), 177.3 bits, see alignment E=4.2e-56 PF04552: Sigma54_DBD" amino acids 326 to 483 (158 residues), 224.4 bits, see alignment E=9.8e-71

Best Hits

Swiss-Prot: 51% identical to RP54_AZOVI: RNA polymerase sigma-54 factor (rpoN) from Azotobacter vinelandii

KEGG orthology group: K03092, RNA polymerase sigma-54 factor (inferred from 51% identity to avn:Avin_12790)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>LRK53_RS15705 RNA polymerase factor sigma-54 (Rhodanobacter sp000427505 FW510-R12)
MKPALQFRLHQQLTLTPQLQQAIRLLQLSQLELEAELRQIAESNPLLEFAEEVEDEEATE
DAVVESDYPSVEAVAATAGDDGETSDWSDGGVAETPIDFSSNSVGSNSGSGTRGDEDFEP
QNAAPETLQQHLLWQLNLASFTPRQHLIATVLIDALNPAGYLAEGLEAILAALPAAFDAS
IAEIEEVRRCLQGFDPAGVASLDLRDCLRVQLEQFDPDTPQRDLALRIVDTELELLARND
ITRLARRLRTDENDVADAAVLIRSLDPRPGAALDATPVEYVAPDVYALRDGTRWRVSLNP
DAQPRLGLNQHYCGLIAQARGEDASWMRGQLQEARWLIKSLESRAETLLKVAEAIVRRQS
AFLDYGPEAMHPLVLREVAEEVGMHESTISRVTTRKYLHTPRGTFELKYFFSSGVSTEDG
GSASATAIQAMLRKLIDAEDVRKPLSDLAIAEELQRKGIQVARRTVAKYREGLRIPTSSE
RQRAG