Protein Info for LRK53_RS15520 in Rhodanobacter sp000427505 FW510-R12

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 67 to 83 (17 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details amino acids 415 to 442 (28 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details PF07690: MFS_1" amino acids 1 to 431 (431 residues), 77.7 bits, see alignment E=8.1e-26 PF13347: MFS_2" amino acids 37 to 229 (193 residues), 28.8 bits, see alignment E=4.9e-11

Best Hits

KEGG orthology group: None (inferred from 62% identity to psm:PSM_A1381)

Predicted SEED Role

"Predicted maltose transporter MalT" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>LRK53_RS15520 MFS transporter (Rhodanobacter sp000427505 FW510-R12)
MCFGFLGIQFGFALQNANVSRIFQTLGANVDQIPLLWIAAPFTGLIVQPLIGYFSDRTWN
RFGRRRPYFFAGAVLATLALLAMPNSPTLWIAAGLLWIMDASFNVSMEPFRAFVGDQLPP
RQRPLGYAMQSVFIGVGAVVASFLPYVLTHFGVANTAPAGEVPHSVKYAFYAGAFVLLAA
MLWTILSTREYPPEQLESFSDNRIEEAPGSVAGAWKIGALLLLLGLVLLGLIRRFALEQE
LYLLAGGLAGFGALFVWLSRTRSDGPLRHIMGDLHGMPLPMRRLNWVQFFSWFAMFAMWI
NTTSAVSQTFYGSSDTTSVAYNEGANWAGVLMGTYNGVGVLAAILIPLLVRACGLRWSHL
INLWLGGLGLLSFLVIRDPHWLIVSMVGVGFAWASILSLPYAMLSDNLPAAKMGVYMGIF
NFFIVIPQLLAASVLGVLLKLFFHSQPIWALGLGGVSLLVAGLCTLRVPEPTAPSSP