Protein Info for LRK53_RS15430 in Rhodanobacter sp000427505 FW510-R12

Annotation: chain-length determining protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details amino acids 492 to 512 (21 residues), see Phobius details PF02706: Wzz" amino acids 6 to 101 (96 residues), 25.9 bits, see alignment E=1e-09 TIGR03007: polysaccharide chain length determinant protein, PEP-CTERM locus subfamily" amino acids 19 to 508 (490 residues), 447.1 bits, see alignment E=2.8e-138 PF13807: GNVR" amino acids 370 to 449 (80 residues), 38.8 bits, see alignment E=7.4e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>LRK53_RS15430 chain-length determining protein (Rhodanobacter sp000427505 FW510-R12)
MQKQSFDLRELFQHVLLEARTSWRYRWHALIVAWCVAIVGAVLVFSLPNKYAANAQVYAD
TEALTNPLLRGVAVQPDVGGRLLIMTQTLLSRPNLEAVADKTGLSLRATTPADKDELLLK
LGAAVTVKGAGPKDLYDISYADPDRRMAQKVVQAFLQILMNETLGANTVSTETAQNFLQQ
QVQAYSNRLNEAEQKLADFQKANVGYVPDQGGSSYSARLQAAETQLQNLQGQYDTTVASR
ATTQQQMRALASSGSTSLGADPRTQDVDKQIATYQQQLNQLLLSYTDEYPDVVSTRRMIA
QLQARRDALRKSAPASPMLGVVSDNPVYQEMQKSMYSTQVSVQALATQIALQKRQIADLK
GSVDKISDVQATLQRLMRNYDVTKKQYDQLVERLNTAELSQDATQSGNNLKFRVINPPVV
PLRPVSPKRGLLLLLVLALALAVGSGFAYFLHKMNPVFVSLKSLRESGNYPVLGGLSLIT
SPSRRRNQRREVAGFCTGAGLLVMVLMLGFAFDGQLARLVQHFFMVGAA