Protein Info for LRK53_RS15410 in Rhodanobacter sp000427505 FW510-R12

Annotation: DUF3473 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR03006: polysaccharide deacetylase family protein, PEP-CTERM locus subfamily" amino acids 13 to 282 (270 residues), 424.6 bits, see alignment E=6.8e-132 PF01522: Polysacc_deac_1" amino acids 46 to 153 (108 residues), 81.1 bits, see alignment E=6.9e-27 PF11959: DUF3473" amino acids 155 to 282 (128 residues), 175.6 bits, see alignment E=4.4e-56

Best Hits

KEGG orthology group: None (inferred from 61% identity to noc:Noc_1981)

Predicted SEED Role

"FIG004655: Polysaccharide deacetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>LRK53_RS15410 DUF3473 domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MSTARPQLEPVTNAMTVDVEDYFQVAAFEQCIRREDWPRWPVRVDGNTRRVLELFERHGV
HATFFVLGWVAERFPALVRDISAAGHEIASHGFGHERLTNLSRAEFRDSITRTKLLLEDT
TGTAVYGYRAPSYSIGPTTLWAHEELRDAGYRYSSSIVPIHHDLYGMPAAPRFPFFTKRS
GLLEIPVTTVRLCGRNWPCGGGGYFRLLPYALFRRGLQRVNRRERRSGVFYFHPWEVDAQ
QPRVPGVTLRNRVRHYLNLPRTAPRLERLVRDFRFDRMDRVFLARASADYPVVALQAVEL
GAH