Protein Info for LRK53_RS15190 in Rhodanobacter sp000427505 FW510-R12

Annotation: flagellar basal body P-ring formation protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF17656: ChapFlgA_N" amino acids 40 to 114 (75 residues), 48.4 bits, see alignment E=1.5e-16 TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 105 to 239 (135 residues), 116 bits, see alignment E=6e-38 PF13144: ChapFlgA" amino acids 118 to 238 (121 residues), 92.1 bits, see alignment E=4.2e-30 PF08666: SAF" amino acids 119 to 175 (57 residues), 35.2 bits, see alignment E=2.3e-12

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 37% identity to nhl:Nhal_0517)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>LRK53_RS15190 flagellar basal body P-ring formation protein FlgA (Rhodanobacter sp000427505 FW510-R12)
MSKTGLLVTGLLLAALGFGAWPQSARADGTTATTQSPDSVRAAAEQAVREHYALPGSRVV
VSAAPLDLRLRLDACREPLRAVVPVYAATSSRLTVPVRCPQPGGWTVRVPLQLQLFRHVL
VTSRPLLRGDGLGAADVHAEERDVARLGYGYIDNLAQVAGRTLARSLAQGSVLSPGALGG
RRMVRAGDRVEMVARLDGIEVRATGVAMGSGDNGARLRVRNESSGKVVDAMVSAPGTVVA
LP