Protein Info for LRK53_RS15045 in Rhodanobacter sp000427505 FW510-R12

Annotation: flagellar motor switch protein FliM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR01397: flagellar motor switch protein FliM" amino acids 3 to 317 (315 residues), 339.9 bits, see alignment E=7e-106 PF02154: FliM" amino acids 48 to 230 (183 residues), 196.4 bits, see alignment E=4.4e-62 PF01052: FliMN_C" amino acids 252 to 316 (65 residues), 61.1 bits, see alignment E=7.9e-21

Best Hits

Swiss-Prot: 57% identical to FLIM_PSEAE: Flagellar motor switch protein FliM (fliM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02416, flagellar motor switch protein FliM (inferred from 64% identity to xac:XAC1947)

Predicted SEED Role

"Flagellar motor switch protein FliM" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>LRK53_RS15045 flagellar motor switch protein FliM (Rhodanobacter sp000427505 FW510-R12)
MSDLLSQDEIDALLDGVSGGAVATGGDEPPPSDAVVTYDFTQQDRIVRGRLPTLEMVNER
FARFFRLGVFNVLRKTCEVSVLGVKMVKFAEYVHSLAVPSNLNLVRIKPLRGTALVVFEP
RLVFTVIDNFFGGDGRFHARIEGRDFTATENRVIQIMLEELFGAMVEAWAPVLELQFEYQ
NSEINPQFANIVSPTETVVVSRFHVELDGGGGEIHLTLPYAMVEPIRTLLDAGVQSDRAD
RDDRWAEMLQEEVFDAEVDLSSLLLDVRLSLGEFLHLRPGDVIPVQLPELATVYAEDVPV
FRGHYGQSGGRNAVRFHAQAGRREKRAAGDQFKEKNPA