Protein Info for LRK53_RS14930 in Rhodanobacter sp000427505 FW510-R12

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 201 to 218 (18 residues), see Phobius details PF08269: dCache_2" amino acids 49 to 192 (144 residues), 93.9 bits, see alignment E=1.6e-30 PF17200: sCache_2" amino acids 51 to 196 (146 residues), 101.4 bits, see alignment E=6.9e-33 PF00015: MCPsignal" amino acids 335 to 491 (157 residues), 180.1 bits, see alignment E=5.2e-57

Best Hits

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (568 amino acids)

>LRK53_RS14930 methyl-accepting chemotaxis protein (Rhodanobacter sp000427505 FW510-R12)
MFSNVHDFFHRLSLNIKVMLVVAVVLVGLVALTVMNTFQGRDLLVRGVQGALQNNVESAI
SIATAWDERAARGELSRAEAQKHALAQIHDMRWGDGAGYVFAFGDDYTLAEHPIMLDRLG
KSVRDMVDRNGKPIFQLMREVDARDGSGVTYYDWPKPTSKKIVGKITYSALYKPWGMHFG
AGAYLDEVDAQFVHMMKVRMARVALMALLVVLVVWLTMQSIRRSIGGEPTFAVKMVGRMA
DGNLSVEGAEGVKLAPGSMMHAMQRLHLKLIEVVGQVQHGSQAVSSAAQQIAKGNDDLSQ
RTQEQASSLEETASSMEEMTSTVRQNAENASHANQLANGAREQAERGGQVVAQAVAAMGE
ISASSRRIADIVGLIDEIAFQTNLLSLNAAVEAARAGEQGRGFAVVASEVRSLSQRSAAA
AKEIKVLIGESVDRVQAGSALVEQSGAALADIVDSVRKVTDIVAEIAAASHEQSAGIDQV
NRAVMQMDEVTQQNAALVEEAAAAARAMQEQAGQLQRQMRFFRLDGAPAKPAQAASASAR
VVALPRKPATRTAEPTRSTAAAGGWTEF