Protein Info for LRK53_RS14905 in Rhodanobacter sp000427505 FW510-R12

Annotation: chemotaxis response regulator protein-glutamate methylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00072: Response_reg" amino acids 6 to 110 (105 residues), 80.8 bits, see alignment E=8.3e-27 PF01339: CheB_methylest" amino acids 171 to 349 (179 residues), 199.7 bits, see alignment E=3.2e-63

Best Hits

Swiss-Prot: 54% identical to CHEB2_BORA1: Protein-glutamate methylesterase/protein-glutamine glutaminase 2 (cheB2) from Bordetella avium (strain 197N)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 62% identity to smt:Smal_1843)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>LRK53_RS14905 chemotaxis response regulator protein-glutamate methylesterase (Rhodanobacter sp000427505 FW510-R12)
MDRVRVLVVDDSALVRKLMSAMLACDPGIEVVGTAADPLIAREKIKQLNPDVLTLDVEMP
RMDGLTFLENLMRLRPMPVVMVSSLTTEGADVTLRALELGAVDFFAKPSSDLASSFGDGA
QEICAKVKLAALARPRARTTVRKLDVAPRLSADAVLPRVQTTGTRGGSPIIAIGASTGGT
EAVRVVLEAMPPDAPPILVTQHIPAAFSGPFAARMDRCSAMRVCEAQDGQPVQSGHAYIA
PGSHHLLVMWDGAKYVCRLHDGPPVNRHRPSVDVLFRSLAASAGAATIATLLTGMGDDGA
RGLLELRQAGAATLVQDEPSSVVWGMPGAAWKLDAAAEMQPIDHMAARLLALARRPHTGA
SGA