Protein Info for LRK53_RS14860 in Rhodanobacter sp000427505 FW510-R12

Annotation: rRNA maturation RNase YbeY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF02130: YbeY" amino acids 36 to 158 (123 residues), 128.2 bits, see alignment E=1.2e-41 TIGR00043: rRNA maturation RNase YbeY" amino acids 54 to 158 (105 residues), 115.9 bits, see alignment E=4.9e-38

Best Hits

Swiss-Prot: 67% identical to YBEY_STRMK: Endoribonuclease YbeY (ybeY) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 67% identity to smt:Smal_1352)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>LRK53_RS14860 rRNA maturation RNase YbeY (Rhodanobacter sp000427505 FW510-R12)
MPHTALPNPESRIPNPVLVHLGYAVPRAGLPAPASFRRWVEAALRGAKRRKGAELAIRIV
DAHEGRALNRDYRGKDYATNVLSFPAELPPGVALPLIGDLAICAPVVLREAAEQGKSPRD
HWAHLTVHGVLHLLGYDHTEEAEAEAMEALETRVLAGLGIADPYA