Protein Info for LRK53_RS14855 in Rhodanobacter sp000427505 FW510-R12

Annotation: PhoH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF02562: PhoH" amino acids 114 to 317 (204 residues), 317.8 bits, see alignment E=4e-99 PF13604: AAA_30" amino acids 119 to 270 (152 residues), 32 bits, see alignment E=1.6e-11 PF13245: AAA_19" amino acids 130 to 270 (141 residues), 25.7 bits, see alignment E=1.7e-09

Best Hits

KEGG orthology group: K06217, phosphate starvation-inducible protein PhoH and related proteins (inferred from 73% identity to alv:Alvin_2684)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>LRK53_RS14855 PhoH family protein (Rhodanobacter sp000427505 FW510-R12)
MTNGLNQRDFTLDPEDNARLANLCGAFDEHLRQVELRLGVEINHRGSIFQVIGEEAPVRA
AEKVLRALYASTGSEMLTGAQINLQLAESGIDAITEAAVEGAQEMVIKVKRGVIKGRGPN
QARYLHAIASHDINFGVGPAGTGKTYLAVASAVEALEANRVQRLILVRPAVEAGEKLGFL
PGDLSQKVDPYLRPLYDALYEMLGFEKVAKLIERNVIEIAPLAYMRGRTLNDSYVILDEA
QNTTVEQMKMFLTRIGFGTVAVITGDVTQVDLPRSTRSGLRQAVEVLRGVTGISFTFFTS
RDVVRHPLVAKIVRAYEAFEEEAGIRDSGLEIREKPKPAT