Protein Info for LRK53_RS14840 in Rhodanobacter sp000427505 FW510-R12

Annotation: trypsin-like peptidase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 29 (23 residues), see Phobius details PF00089: Trypsin" amino acids 106 to 273 (168 residues), 68.4 bits, see alignment E=1.7e-22 PF13365: Trypsin_2" amino acids 113 to 247 (135 residues), 115 bits, see alignment E=9.7e-37 PF13180: PDZ_2" amino acids 309 to 374 (66 residues), 30.7 bits, see alignment E=6.5e-11 PF17820: PDZ_6" amino acids 312 to 348 (37 residues), 31.1 bits, see alignment 3.3e-11

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 49% identity to dar:Daro_3371)

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>LRK53_RS14840 trypsin-like peptidase domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MKHAAGTLLFIARFAILGLAMAFVVGLFWPGSGGRLRERFGLRPATPSATPASPGRGPVS
YADAVAAAAPSVVNIYANRIVTEQAVRMYDNPVLQQLFGGQPTTFQHREQTLGSGVIVSA
QGQGYVLTNNHVIARAADIQVLLYDGRIAKASLVGADEESDLAVLKIDASNLPVIHIAGQ
PLRPGDVVLAIGNPLGLNQTVTMGIVSAIGRQLNSSSAEDFIQTDAAINLGNSGGALVNA
EGELVGINTLLIGKAAGAEGIGFAIPVTTAKKVLDQIIATGHVVRGWLGADYAFVPVAAN
GGLPGAARGALVTMAYPGSPAALAGIRPRDILLRIGSDDILDPTDLRRREAALKPGSTVT
ISGLRNGSPFHLEVTPVQRPALSAGSMPDS