Protein Info for LRK53_RS14835 in Rhodanobacter sp000427505 FW510-R12

Annotation: ubiquinol-cytochrome c reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF10399: UCR_Fe-S_N" amino acids 6 to 40 (35 residues), 39.4 bits, see alignment 3.2e-14 TIGR01416: ubiquinol-cytochrome c reductase, iron-sulfur subunit" amino acids 9 to 194 (186 residues), 229.5 bits, see alignment E=1.4e-72 PF00355: Rieske" amino acids 117 to 181 (65 residues), 27.9 bits, see alignment E=1.9e-10

Best Hits

Swiss-Prot: 54% identical to UCRI_ALLVD: Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K00411, ubiquinol-cytochrome c reductase iron-sulfur subunit [EC: 1.10.2.2] (inferred from 61% identity to psu:Psesu_0829)

Predicted SEED Role

"Ubiquinol-cytochrome C reductase iron-sulfur subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>LRK53_RS14835 ubiquinol-cytochrome c reductase iron-sulfur subunit (Rhodanobacter sp000427505 FW510-R12)
MANEVVDHGRRRFLTATTSVVGGIGIVAAAVPFIKSWEPSARAKAAGAPVTQSLAKIEAG
QMLTVSWRSLPVFVLNRTKAQLATLPMVDSRLVDPKSDGGSADQQPKYAQNEARSIKPEW
LVVIGICTHLGCVPDFVPEIKPEPFDPDWKGGFYCPCHKSRYDLAGRVYAGVPAPKNLPV
PPYHFIDDSTIQIGVDPKEAG