Protein Info for LRK53_RS14740 in Rhodanobacter sp000427505 FW510-R12

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00027: cNMP_binding" amino acids 59 to 139 (81 residues), 50.5 bits, see alignment E=2.5e-17 PF13545: HTH_Crp_2" amino acids 173 to 245 (73 residues), 67.9 bits, see alignment E=9.3e-23 PF00325: Crp" amino acids 197 to 228 (32 residues), 49.8 bits, see alignment 3.4e-17

Best Hits

Swiss-Prot: 39% identical to ETRA_SHEON: Electron transport regulator A (etrA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 61% identity to psu:Psesu_0364)

Predicted SEED Role

"Fumarate and nitrate reduction regulatory protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>LRK53_RS14740 helix-turn-helix domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MRRNHPAGRLPEPPSPIADDGDETHFCRTCAFSGACIAEGYGKPELVELHCLVEHVGPFH
AGEHIFRTGDPFRSIFAVRAGTVKTSMVDPAGREQVLGFYLPGEVIGLNAIYPDRFPCDA
MALDTAYFCRFSFPAMSALATRMPAVQQRLFRLISKELGMATLLAGDHNADVRMAAFLTD
LAARYKERGFSGTRFHLSMSRGDIANYLRLAAETVSRVLSRFRQQGLIELEGREMVLRDP
ERLCAIGKNLLPQ