Protein Info for LRK53_RS14690 in Rhodanobacter sp000427505 FW510-R12

Annotation: hemolysin III family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details PF03006: HlyIII" amino acids 14 to 211 (198 residues), 136.5 bits, see alignment E=5.6e-44 TIGR01065: channel protein, hemolysin III family" amino acids 17 to 217 (201 residues), 199.6 bits, see alignment E=2.1e-63

Best Hits

Swiss-Prot: 48% identical to YQFA_ECOLI: UPF0073 inner membrane protein YqfA (yqfA) from Escherichia coli (strain K12)

KEGG orthology group: K11068, hemolysin III (inferred from 68% identity to tin:Tint_0888)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>LRK53_RS14690 hemolysin III family protein (Rhodanobacter sp000427505 FW510-R12)
MSPTRSGAIARTQSWREELANSLSHGLGLLLAIAGLPVLVLRADHLDSGYAMAGALSFGG
SAVLLYLASTLYHAMAHPKAKAILRALDHAAIYLLIAGTYTPITLGVLRGGWGWGLFGLV
WGLALAGMLFKALGGMRFPRVSTALYLAMGWVGVIAIHPLWVRMETGGLAWLAAGGLAYS
LGVVFFVLDEKLRYSHFIWHLFVLAGTTCHFFAVLLYAF