Protein Info for LRK53_RS14650 in Rhodanobacter sp000427505 FW510-R12

Annotation: bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF01967: MoaC" amino acids 14 to 149 (136 residues), 137.4 bits, see alignment E=3.2e-44 TIGR00177: molybdenum cofactor synthesis domain" amino acids 180 to 316 (137 residues), 99.2 bits, see alignment E=1e-32 PF00994: MoCF_biosynth" amino acids 182 to 324 (143 residues), 98.4 bits, see alignment E=3.1e-32

Best Hits

KEGG orthology group: None (inferred from 74% identity to smt:Smal_2243)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC / Molybdenum cofactor biosynthesis protein MoaB" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>LRK53_RS14650 bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB (Rhodanobacter sp000427505 FW510-R12)
MTLPATEHVAAFHMADIRDKRPTRRRAVAVGELQAGPVAWPLIVERRLPKGDALVMAEVA
GLQGAKQASALMPLCHPLPLELVRVHCEPVAERLAIRVYCEVATEARTGVEMEALAGVNA
ALLTLYDLSKPVEPALAIGGIRLLFKEGGKSGLWRHPEGMSEAEQAHYRPRDIARLQGVS
CAVVTLSDRAHEGRYEDRSGPLLVEGLRQLGAQVDHVDVLPDGVQPLAAHLRALAAAQVR
LCLCTGGTGLGPRDLTPEALAQVADRRVSGLAEMLRSESARHTPQAWLSRAEAVQLGRML
VLAMPGSPRAAGQGLAIVGPLLAHALAMMDGEAHP