Protein Info for LRK53_RS14570 in Rhodanobacter sp000427505 FW510-R12

Annotation: molybdate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 36 to 50 (15 residues), see Phobius details PF13531: SBP_bac_11" amino acids 65 to 287 (223 residues), 185.2 bits, see alignment E=1.6e-58 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 69 to 286 (218 residues), 184.8 bits, see alignment E=1.1e-58 PF01547: SBP_bac_1" amino acids 71 to 273 (203 residues), 26.2 bits, see alignment E=7.8e-10

Best Hits

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 50% identity to tbd:Tbd_1283)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>LRK53_RS14570 molybdate ABC transporter substrate-binding protein (Rhodanobacter sp000427505 FW510-R12)
MPIATCAPESTGHAGATHLEEQTLQFDIIRRLVRRVAPVMLAIAGLATWPAGHTVAGTPP
VAQARIAVAANFAEVAHLLAEQYTRRSGNRIDISVASTGKLYAQIHHGAPFDVLLAADDS
TPQRLVDEGLAVRSSLYDYATGRLVLWSRDATLAADGEQVLRQHDFRKFAIANPALAPYG
AAARQVLQHVGRWDALQPRLVLGENVGQATQFVLSGNAEAGLLPRSLVLEAQRQVGGSAW
LVPADWHRPIVQSAVLLDHGRDNPAAIGFLAYLHDDTARRTIAAHGYD