Protein Info for LRK53_RS14515 in Rhodanobacter sp000427505 FW510-R12

Annotation: cyclic nucleotide-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00027: cNMP_binding" amino acids 47 to 131 (85 residues), 60.6 bits, see alignment E=1.7e-20 PF13545: HTH_Crp_2" amino acids 166 to 236 (71 residues), 51.4 bits, see alignment E=1.3e-17 PF00325: Crp" amino acids 190 to 221 (32 residues), 53.2 bits, see alignment 2.9e-18

Best Hits

Swiss-Prot: 44% identical to BTR_BORPE: Transcriptional regulatory protein btr (btr) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 43% identity to alv:Alvin_0388)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>LRK53_RS14515 cyclic nucleotide-binding domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MVSEASIFDLNQLRRSCSSCALGELCLPAGIDRTDLDRLDTTVRDKRTLDRGGALYHDGD
PFEALYVVRSGSLKTFVQDESGDVQILGFHLPGEIVGFDALALNRHVSQAEALERSSICE
LPYGRLQQVVSEVPALQRQLMRVISREAIEEHRHLVMMGRQQAQEQLAIFLKSLADRYQR
LQRDGIALSLPMSRYDIANYLGLAVETVSRLFSRLEEMGVLEVNRKAVRILRSDLLTGLC
HSGTTSTKRHGAG