Protein Info for LRK53_RS14510 in Rhodanobacter sp000427505 FW510-R12

Annotation: cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 180 (172 residues), 91.2 bits, see alignment E=3.7e-30

Best Hits

Swiss-Prot: 40% identical to C56H_ECOLI: Cytochrome b561 homolog 1 (yodB) from Escherichia coli (strain K12)

KEGG orthology group: K12262, cytochrome b561 (inferred from 65% identity to gca:Galf_2649)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>LRK53_RS14510 cytochrome b (Rhodanobacter sp000427505 FW510-R12)
MNWKNTSERYGALMIGMHWLTLLLLVAVYACIELRESYPRGSELREGLKSWHFMLGLGVF
VLVFVRLVIRLVSGARPVVRPVLPVWQERLAALMHLALYAFLILMPLLGWLVLSAEGKPI
PFFGMQWPALVGPDKAFADSLEELHETIGTVGYYLVGLHAAAALAHHYVSRDNTLLRMLP
RRGRPAS