Protein Info for LRK53_RS14505 in Rhodanobacter sp000427505 FW510-R12

Annotation: ferric reductase-like transmembrane domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details PF01794: Ferric_reduct" amino acids 56 to 190 (135 residues), 65.6 bits, see alignment E=4.5e-22 PF08022: FAD_binding_8" amino acids 263 to 327 (65 residues), 22.8 bits, see alignment E=8.3e-09

Best Hits

KEGG orthology group: None (inferred from 66% identity to sno:Snov_1163)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>LRK53_RS14505 ferric reductase-like transmembrane domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MERLRIATASRVPHAQSQACILGALAFLVLLWLVAEPTVFRSSTFFGLRDAMVQLTGFVA
IGCMSLAMVPALRPRWPEAWLGGLDKMYCMHKWLGISVLVVAIIHGLWAQGPKWAVGWGW
LEPPDHGAQGAPENPMASLLASQRGAAESVGEWVFYAVVVLIALALIRRFPYHLFYKTHR
LLAVGYLALVFHAVVLMEFHHWATPIGWLAAVLLACGSWAAIVVLLRRVGARSQVAGRIT
ALHLFAGVDSLEIETEVQGWPGHKSGQFAFLTAGAADGAHPYTIASGWRQETSRITFVVK
DLGDHTHRLHEKLRVVEQAVRVEGPYGCFTFDDGCARQIWIGGGIGITPFIGRMKHMAWQ
KEDRDWPEGQKIDLFHSTADVDDEALDRLAGDARSADVRLHVLIDARDDRLTGERIRAVV
PEWREASIWFCGPAGFGEALKHDLARHGFPVERRFHQELFAMR