Protein Info for LRK53_RS14480 in Rhodanobacter sp000427505 FW510-R12

Annotation: MBL fold metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 PF00753: Lactamase_B" amino acids 44 to 277 (234 residues), 52.3 bits, see alignment E=1.4e-17 PF12706: Lactamase_B_2" amino acids 55 to 126 (72 residues), 28.2 bits, see alignment E=2.7e-10 PF10996: Beta-Casp" amino acids 284 to 409 (126 residues), 136.4 bits, see alignment E=1.5e-43 PF07521: RMMBL" amino acids 422 to 465 (44 residues), 51.5 bits, see alignment 1.6e-17

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 58% identity to afr:AFE_2679)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>LRK53_RS14480 MBL fold metallo-hydrolase (Rhodanobacter sp000427505 FW510-R12)
MTTINPAAGVPCQGLPPAGRTATTRTIEERMIIYSCHGAAKQVTGSCHLITCNDRRVLVD
CGMFQGSDEVERANAEPFGFDPAGIDVLLLTHAHLDHCGRIPLLVRQGFRGRILTTAATR
ELARVVMLDAAGLQEEDARRAQRNNRRSEAVALPLYTLDDALHALDFFGADIGYDETVQV
VEGISARFLDAGHILGSASVLLELDDGKQRRRMLFSGDLGNPGRPLLRDPTPAPPADYVV
MESTYGDRPHRSVPDSVDEMYQAIRETVNRRGNVVIPTFALERTQEILYYLHRGILDGAI
PQHVRVFLDSPMAISATEIFRRHPESFDERFLDELRHGDPFAMPGLHFTRETAESMAINN
IDGGAVILAGSGMCNGGRVRHHLKHNLWRERSSVVFVGYAAEGTLARRIIDGAASVRVFN
EEIPVRAQVWTINGFSAHADQPSLLAWLGDAPRRQVFLVHGEYERGMRVMQEALEARSVA
VQLPGLHEPIKID