Protein Info for LRK53_RS14295 in Rhodanobacter sp000427505 FW510-R12

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF07992: Pyr_redox_2" amino acids 15 to 298 (284 residues), 70.4 bits, see alignment E=2.8e-23 PF13738: Pyr_redox_3" amino acids 69 to 295 (227 residues), 56.4 bits, see alignment E=4.4e-19

Best Hits

Swiss-Prot: 55% identical to FENR2_CUPNJ: Ferredoxin--NADP reductase 2 (Reut_A2287) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 57% identity to hse:Hsero_1624)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>LRK53_RS14295 NAD(P)/FAD-dependent oxidoreductase (Rhodanobacter sp000427505 FW510-R12)
MIPVHTADSLMINCDTVIIGAGPVGLFQVFELGLLGLDAHVIDAVPHAGGQCVELYPDKP
IYDIPALPVCSGRELIERLQQQIRPFAPQFHLGHTVTSLQRMDNGRFHLQTSGGLAFDAG
VVIIAGGLGAFAPRTLDLPEAAPLVGRTLHYKVTQPALCDDQDIVIAGGGDAALDWALAL
VERVRSLVLVHRSSSFRAAPASVARMQALCDEGRMQFCEGDIVGLETAAGALSQVRVRTR
SGMVQRIEASHLLVFWGLHPALGPIADWGLALERQQLVVDPSTLQTSVPGIFAVGDINTY
PGKKKLILSGFHETALCAFAAHAHLHPGDKVNLQYTTTSPALQRRLGVRDAKGADVVAQP
PSRVEASAA