Protein Info for LRK53_RS13700 in Rhodanobacter sp000427505 FW510-R12

Annotation: RNA-binding S4 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF01479: S4" amino acids 13 to 57 (45 residues), 36.1 bits, see alignment E=4.4e-13 PF28601: HSP15_C" amino acids 92 to 131 (40 residues), 27.8 bits, see alignment E=1.9e-10

Best Hits

Swiss-Prot: 43% identical to HSLR_ECO57: Heat shock protein 15 (hslR) from Escherichia coli O157:H7

KEGG orthology group: K04762, ribosome-associated heat shock protein Hsp15 (inferred from 53% identity to psu:Psesu_1003)

Predicted SEED Role

"Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog)" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>LRK53_RS13700 RNA-binding S4 domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MSKPPDLPMTDLRADVWLWAARFFKTRSLAKQAIDGGRIDVNGAGCKPAKSLRVGDRLKI
GRGEERLEVEVVALSDRRGPAAVAQALYVETAASCAARELAREQHRLVGPNGPPKRPDKQ
ARRELRRLRDNR