Protein Info for LRK53_RS13565 in Rhodanobacter sp000427505 FW510-R12
Annotation: isocitrate dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 50% identical to IDH3A_MACFA: Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial (Fragment) (IDH3A) from Macaca fascicularis
KEGG orthology group: K00030, isocitrate dehydrogenase (NAD+) [EC: 1.1.1.41] (inferred from 73% identity to csa:Csal_1434)Predicted SEED Role
"Isocitrate dehydrogenase [NAD] (EC 1.1.1.41)" in subsystem TCA Cycle (EC 1.1.1.41)
MetaCyc Pathways
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
- TCA cycle III (animals) (9/10 steps found)
- TCA cycle II (plants and fungi) (8/9 steps found)
- nitrogen remobilization from senescing leaves (7/8 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.1.1.41
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (337 amino acids)
>LRK53_RS13565 isocitrate dehydrogenase (Rhodanobacter sp000427505 FW510-R12) MNKTIAVIPGDGIGPEIMTATLRVLDALDCGLSYDLADAGMVALEKHGDLLPKATLDKIA EHKVALKGPLTTPIGGGFTSVNVTLRRHFDLYANVRPAVSFPGTKSRYENIDIITVRENT EGAYRSEGQTLSVDGEVAESVARNTRKGSSRIVRYAFELAVKKGRKKVTAVHKANILKTS SGLFLNVAREIAREYPQIEFNEMIVDNTCMQLVMNPYQFDVIVTTNLFGDILSDLCAGLV GGLGLAPGDNIGEGAAIFEAVHGSAPDIAGKGIANPCALLLAAADMLDHLDMVAKGDRLR QAIRDTMTNDRDSVTPDIGGKGSTSSFADAIVKRLAA