Protein Info for LRK53_RS12730 in Rhodanobacter sp000427505 FW510-R12

Annotation: heme lyase CcmF/NrfE family subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 248 to 264 (17 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details amino acids 389 to 412 (24 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details amino acids 449 to 468 (20 residues), see Phobius details amino acids 488 to 505 (18 residues), see Phobius details amino acids 612 to 632 (21 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 53 to 637 (585 residues), 737.9 bits, see alignment E=5.3e-226 PF01578: Cytochrom_C_asm" amino acids 89 to 295 (207 residues), 181 bits, see alignment E=2.4e-57 PF16327: CcmF_C" amino acids 315 to 634 (320 residues), 380.8 bits, see alignment E=5.8e-118

Best Hits

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 74% identity to xca:xccb100_2600)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmF" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (659 amino acids)

>LRK53_RS12730 heme lyase CcmF/NrfE family subunit (Rhodanobacter sp000427505 FW510-R12)
MTPELGQLALILALLLALAQSILPLIGAWRGNRALMAVARPAAAGQAVFVAMAFGILAWA
FLHFDFSVQYVADNSNLALPWYYRIAAVWGAHEGSLLLWILILNLWTVALAAFSQKLPEV
FASRVLAVMGLIAVGFLAFIIFTSNPFGRLLPMPGDGADLNPVLQDPGMTFHPPMLYMGY
VGFSVAFAFSIAALLGGELEQAWVRWARPWTNVAWAFLTCGIVAGSWWAYAELGWGGWWF
WDPVENASFMPWLVGVALIHAQAVTEKRGSLRAWTILLSIFAFSLSLLGTFLVRSGVLTS
VHAFASDPRRGVFILAFLTIVVGGSLLVYALRAPKVLGGKPFQVVSRETALLTSNLMFAV
AAAMVLLGTLFPLIGDAMNLGRISVGPPYFGFLFPLLMLPVVLLLPFGPFLRWGKGEASA
LKSLLLRVAIAALACAIIAAFLVDGNLKAIVGVAAGVWVVVGVLLYAYKRWREMPRGRRY
PTEMAGMLMAHLGVGVFVVGVLLSESLSVTRDVRMAPGESQRIGSYEFRFDGVHHTTGPN
WTADQGAVTVTRGEKRIAVMHPQKRTYPRGQVQTESAVDAGVTRDLYVALGEPMDANDIE
GAWALRLYYKPFIRWIWAGGLLMMLGGLVCAADKRFRLKRSATVGAPATDGLLPQETRA