Protein Info for LRK53_RS12285 in Rhodanobacter sp000427505 FW510-R12

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 301 to 321 (21 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 403 to 428 (26 residues), see Phobius details amino acids 440 to 463 (24 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 38 to 463 (426 residues), 296.5 bits, see alignment E=1.6e-92 PF03448: MgtE_N" amino acids 48 to 149 (102 residues), 87.9 bits, see alignment E=8.9e-29 PF00571: CBS" amino acids 215 to 270 (56 residues), 32.7 bits, see alignment 1.1e-11 PF01769: MgtE" amino acids 335 to 458 (124 residues), 115 bits, see alignment E=4e-37

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 69% identity to ppw:PputW619_3760)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>LRK53_RS12285 magnesium transporter (Rhodanobacter sp000427505 FW510-R12)
MIELEARSAASRLHDQLETIVDLLHRHEEDGRLPAEVLADLRQQLDELHPADIAFILESL
PLDDRLAVWQLVKADRDGEILLEVSDAVRESLIADMDRHEILAAVEPLDADELADLVEDL
PTAVLPELMASLDTQQREQVQSALSYEEDQVGALMDFEMVTIREDVSLEVVLRYLRRFDE
LPAQTDKLFVINHGNLLTGVLPLHWLLVNPPEKMVSAVMAPDVNTFHPTDDAYDVAQAFE
RYDLVTAPVVDERGHLIGRITIDAMVDVIREEGESEALSRGGLREEEDIFASVWASLKNR
WAWLAINLVTAFIASRVIGLFEGSIERLVALAALMPIVAGIGGNSGNQTTTMIVRALALN
QITAESAKRLWRKELTVSLLNGLVWGGVIGVVAWLLYDSVSLGLVMTAAMTLNLLLAAFV
GVGIPVLMTKFGRDPALGSSVLITAMTDSGGFFIFLGLATVFLM